coderet Wiki The master copies of EMBOSS documentation are available at http://emboss.open-bio.org/wiki/Appdocs on the EMBOSS Wiki. Please help by correcting and extending the Wiki pages. Function Extract CDS, mRNA and translations from feature tables Description coderet extracts the coding nucleotide sequence (CDS), messenger RNA nucleotide sequence (mRNA) and translations specified by the feature tables of the input sequence(s). If the sequences to be extracted are in other entries of that database, they are automatically fetched and incorporated correctly into the output. For each input sequence, an output sequence file is written containing any CDS, mRNA and protein translation sequences from the input feature table. Optionally, the CDS, mRNA, translated protein sequence and non-coding nucleotide sequence regions may be written to separate files. Usage Here is a sample session with coderet To extract all of the CDS, mRNA, non-coding and the protein translations: % coderet Extract CDS, mRNA and translations from feature tables Input nucleotide sequence(s): tembl:x03487 Output file [x03487.coderet]: Coding nucleotide output sequence(s) (optional) [x03487.cds]: Messenger RNA nucleotide output sequence(s) (optional) [x03487.mrna]: Translated coding protein output sequence(s) (optional) [x03487.prot]: Non-coding nucleotide output sequence(s) (optional) [x03487.noncoding]: Go to the input files for this example Go to the output files for this example Example 2 To only extract the mRNA sequence: % coderet -nocds -notranslation -norest Extract CDS, mRNA and translations from feature tables Input nucleotide sequence(s): tembl:X03487 Output file [x03487.coderet]: Messenger RNA nucleotide output sequence(s) (optional) [x03487.mrna]: Go to the input files for this example Go to the output files for this example Command line arguments Extract CDS, mRNA and translations from feature tables Version: EMBOSS:6.6.0.0 Standard (Mandatory) qualifiers: [-seqall] seqall Nucleotide sequence(s) filename and optional format, or reference (input USA) [-outfile] outfile [*.coderet] Output file name [-cdsoutseq] seqoutall [.] Coding nucleotide output sequence(s) (optional) [-mrnaoutseq] seqoutall [.] Messenger RNA nucleotide output sequence(s) (optional) [-translationoutseq] seqoutall [.] Translated coding protein output sequence(s) (optional) [-restoutseq] seqoutall [.] Non-coding nucleotide output sequence(s) (optional) Additional (Optional) qualifiers: (none) Advanced (Unprompted) qualifiers: (none) Associated qualifiers: "-seqall" associated qualifiers -sbegin1 integer Start of each sequence to be used -send1 integer End of each sequence to be used -sreverse1 boolean Reverse (if DNA) -sask1 boolean Ask for begin/end/reverse -snucleotide1 boolean Sequence is nucleotide -sprotein1 boolean Sequence is protein -slower1 boolean Make lower case -supper1 boolean Make upper case -scircular1 boolean Sequence is circular -squick1 boolean Read id and sequence only -sformat1 string Input sequence format -iquery1 string Input query fields or ID list -ioffset1 integer Input start position offset -sdbname1 string Database name -sid1 string Entryname -ufo1 string UFO features -fformat1 string Features format -fopenfile1 string Features file name "-outfile" associated qualifiers -odirectory2 string Output directory "-cdsoutseq" associated qualifiers -osformat3 string Output seq format -osextension3 string File name extension -osname3 string Base file name -osdirectory3 string Output directory -osdbname3 string Database name to add -ossingle3 boolean Separate file for each entry -oufo3 string UFO features -offormat3 string Features format -ofname3 string Features file name -ofdirectory3 string Output directory "-mrnaoutseq" associated qualifiers -osformat4 string Output seq format -osextension4 string File name extension -osname4 string Base file name -osdirectory4 string Output directory -osdbname4 string Database name to add -ossingle4 boolean Separate file for each entry -oufo4 string UFO features -offormat4 string Features format -ofname4 string Features file name -ofdirectory4 string Output directory "-translationoutseq" associated qualifiers -osformat5 string Output seq format -osextension5 string File name extension -osname5 string Base file name -osdirectory5 string Output directory -osdbname5 string Database name to add -ossingle5 boolean Separate file for each entry -oufo5 string UFO features -offormat5 string Features format -ofname5 string Features file name -ofdirectory5 string Output directory "-restoutseq" associated qualifiers -osformat6 string Output seq format -osextension6 string File name extension -osname6 string Base file name -osdirectory6 string Output directory -osdbname6 string Database name to add -ossingle6 boolean Separate file for each entry -oufo6 string UFO features -offormat6 string Features format -ofname6 string Features file name -ofdirectory6 string Output directory General qualifiers: -auto boolean Turn off prompts -stdout boolean Write first file to standard output -filter boolean Read first file from standard input, write first file to standard output -options boolean Prompt for standard and additional values -debug boolean Write debug output to program.dbg -verbose boolean Report some/full command line options -help boolean Report command line options and exit. More information on associated and general qualifiers can be found with -help -verbose -warning boolean Report warnings -error boolean Report errors -fatal boolean Report fatal errors -die boolean Report dying program messages -version boolean Report version number and exit Input file format coderet reads one or more nucleic sequences having CDS, mRNA or translation headings in their feature tables. The input is a standard EMBOSS sequence query (also known as a 'USA') with associated feature information. Major sequence database sources defined as standard in EMBOSS installations include srs:embl, srs:uniprot and ensembl Data can also be read from sequence output in any supported format written by an EMBOSS or third-party application. The input format can be specified by using the command-line qualifier -sformat xxx, where 'xxx' is replaced by the name of the required format. The available format names are: text, html, xml (uniprotxml), obo, embl (swissprot) Where the sequence format has no feature information, a second file can be read to load the feature data. The file is specified with the qualifier -ufo xxx and the feature format is specified with the qualifier -fformat xxx See: http://emboss.sf.net/docs/themes/SequenceFormats.html for further information on sequence formats. See: http://emboss.sf.net/docs/themes/FeatureFormats.html for further information on feature formats. Input files for usage example 'tembl:x03487' is a sequence entry in the example nucleic acid database 'tembl' Database entry: tembl:x03487 ID X03487; SV 1; linear; genomic DNA; STD; HUM; 512 BP. XX AC X03487; XX DT 02-JUL-1986 (Rel. 09, Created) DT 24-AUG-2005 (Rel. 84, Last updated, Version 3) XX DE Human apoferritin H gene exon 1 XX KW ferritin. XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; OC Homo. XX RN [1] RP 1-512 RX DOI; 10.1093/nar/14.2.721. RX PUBMED; 3003694. RA Costanzo F., Colombo M., Staempfli S., Santoro C., Marone M., Frank R., RA Delius H., Cortese R.; RT "Structure of gene and pseudogenes of human apoferritin H"; RL Nucleic Acids Res. 14(2):721-736(1986). XX DR Ensembl-Gn; ENSG00000167996; Homo_sapiens. DR Ensembl-Tr; ENST00000273550; Homo_sapiens. DR Ensembl-Tr; ENST00000406545; Homo_sapiens. DR RFAM; RF00037; IRE. XX FH Key Location/Qualifiers FH FT source 1..512 FT /organism="Homo sapiens" FT /mol_type="genomic DNA" FT /db_xref="taxon:9606" FT misc_feature 65..70 FT /note="GGGCGG box" FT misc_feature 103..108 FT /note="GGGCGG box" FT misc_feature 126..131 FT /note="GGGCGG box" FT promoter 150..154 FT /note="put. TATA box" FT mRNA 179..500 FT /note="exon 1" FT CDS join(387..500,X03488.1:50..196,X03488.1:453..578, FT X03488.1:674..838) FT /product="apoferritin H subunit" FT /db_xref="GDB:120617" FT /db_xref="GOA:P02794" FT /db_xref="HGNC:3976" FT /db_xref="InterPro:IPR001519" FT /db_xref="InterPro:IPR008331" FT /db_xref="InterPro:IPR009040" FT /db_xref="InterPro:IPR009078" FT /db_xref="InterPro:IPR012347" FT /db_xref="InterPro:IPR014034" FT /db_xref="PDB:1FHA" FT /db_xref="PDB:2CEI" FT /db_xref="PDB:2CHI" FT /db_xref="PDB:2CIH" FT /db_xref="PDB:2CLU" FT /db_xref="PDB:2CN6" FT /db_xref="PDB:2CN7" FT /db_xref="PDB:2FHA" FT /db_xref="PDB:2IU2" FT /db_xref="PDB:2Z6M" FT /db_xref="PDB:3AJO" FT /db_xref="PDB:3AJP" FT /db_xref="PDB:3AJQ" FT /db_xref="PDB:3ERZ" FT /db_xref="PDB:3ES3" FT /db_xref="UniProtKB/Swiss-Prot:P02794" FT /protein_id="CAA27205.1" FT /translation="MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRD FT DVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECA FT LHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPE FT SGLAEYLFDKHTLGDSDNES" FT intron 501..>512 FT /note="intron I" XX SQ Sequence 512 BP; 80 A; 212 C; 152 G; 64 T; 4 other; agnncaaacc tnagctccgc cagagcgcgc gaggcctcca gcggccgccc ctcccccaca 60 gcaggggcgg ggntcccgcg cccaccggaa ggagcgggct cggggcgggc ggcgctgatt 120 ggccggggcg ggcctgacgc cgacgcggct ataagagacc acaagcgacc cgcagggcca 180 gacgttcttc gccgagagtc gtcggggttt cctgcttcaa cagtgcttgg acggaacccg 240 gcgctcgttc cccaccccgg ccggccgccc atagccagcc ctccgtcgac ctcttcaccg 300 caccctcgga ctgccccaag gcccccgccg ccgctccagc gccgcgcagc caccgccgcc 360 gccgccgcct ctccttagtc gccgccatga cgaccgcgtc cacctcgcag gtgcgccaga 420 actaccacca ggactcagag gccgccatca accgccagat caacctggag ctctacgcct 480 cctacgttta cctgtccatg gtgagcgcgg gc 512 // Input files for usage example 2 Database entry: tembl:X03487 ID X03487; SV 1; linear; genomic DNA; STD; HUM; 512 BP. XX AC X03487; XX DT 02-JUL-1986 (Rel. 09, Created) DT 24-AUG-2005 (Rel. 84, Last updated, Version 3) XX DE Human apoferritin H gene exon 1 XX KW ferritin. XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; OC Homo. XX RN [1] RP 1-512 RX DOI; 10.1093/nar/14.2.721. RX PUBMED; 3003694. RA Costanzo F., Colombo M., Staempfli S., Santoro C., Marone M., Frank R., RA Delius H., Cortese R.; RT "Structure of gene and pseudogenes of human apoferritin H"; RL Nucleic Acids Res. 14(2):721-736(1986). XX DR Ensembl-Gn; ENSG00000167996; Homo_sapiens. DR Ensembl-Tr; ENST00000273550; Homo_sapiens. DR Ensembl-Tr; ENST00000406545; Homo_sapiens. DR RFAM; RF00037; IRE. XX FH Key Location/Qualifiers FH FT source 1..512 FT /organism="Homo sapiens" FT /mol_type="genomic DNA" FT /db_xref="taxon:9606" FT misc_feature 65..70 FT /note="GGGCGG box" FT misc_feature 103..108 FT /note="GGGCGG box" FT misc_feature 126..131 FT /note="GGGCGG box" FT promoter 150..154 FT /note="put. TATA box" FT mRNA 179..500 FT /note="exon 1" FT CDS join(387..500,X03488.1:50..196,X03488.1:453..578, FT X03488.1:674..838) FT /product="apoferritin H subunit" FT /db_xref="GDB:120617" FT /db_xref="GOA:P02794" FT /db_xref="HGNC:3976" FT /db_xref="InterPro:IPR001519" FT /db_xref="InterPro:IPR008331" FT /db_xref="InterPro:IPR009040" FT /db_xref="InterPro:IPR009078" FT /db_xref="InterPro:IPR012347" FT /db_xref="InterPro:IPR014034" FT /db_xref="PDB:1FHA" FT /db_xref="PDB:2CEI" FT /db_xref="PDB:2CHI" FT /db_xref="PDB:2CIH" FT /db_xref="PDB:2CLU" FT /db_xref="PDB:2CN6" FT /db_xref="PDB:2CN7" FT /db_xref="PDB:2FHA" FT /db_xref="PDB:2IU2" FT /db_xref="PDB:2Z6M" FT /db_xref="PDB:3AJO" FT /db_xref="PDB:3AJP" FT /db_xref="PDB:3AJQ" FT /db_xref="PDB:3ERZ" FT /db_xref="PDB:3ES3" FT /db_xref="UniProtKB/Swiss-Prot:P02794" FT /protein_id="CAA27205.1" FT /translation="MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRD FT DVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECA FT LHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPE FT SGLAEYLFDKHTLGDSDNES" FT intron 501..>512 FT /note="intron I" XX SQ Sequence 512 BP; 80 A; 212 C; 152 G; 64 T; 4 other; agnncaaacc tnagctccgc cagagcgcgc gaggcctcca gcggccgccc ctcccccaca 60 gcaggggcgg ggntcccgcg cccaccggaa ggagcgggct cggggcgggc ggcgctgatt 120 ggccggggcg ggcctgacgc cgacgcggct ataagagacc acaagcgacc cgcagggcca 180 gacgttcttc gccgagagtc gtcggggttt cctgcttcaa cagtgcttgg acggaacccg 240 gcgctcgttc cccaccccgg ccggccgccc atagccagcc ctccgtcgac ctcttcaccg 300 caccctcgga ctgccccaag gcccccgccg ccgctccagc gccgcgcagc caccgccgcc 360 gccgccgcct ctccttagtc gccgccatga cgaccgcgtc cacctcgcag gtgcgccaga 420 actaccacca ggactcagag gccgccatca accgccagat caacctggag ctctacgcct 480 cctacgttta cctgtccatg gtgagcgcgg gc 512 // Output file format The output is a standard EMBOSS sequence file. The results can be output in one of several styles by using the command-line qualifier -osformat xxx, where 'xxx' is replaced by the name of the required format. The available format names are: embl, genbank, gff, pir, swiss, dasgff, debug, listfile, dbmotif, diffseq, excel, feattable, motif, nametable, regions, seqtable, simple, srs, table, tagseq. See: http://emboss.sf.net/docs/themes/SequenceFormats.html for further information on sequence formats. The output is a sequence file containing any CDS, mRNA and protein translation sequences as specified by the feature table of the sequence(s). One or more of CDS, mRNA, translation can be excluded from the output by using the appropriate qualifiers to the program (i.e. -nocds, etc.) The ID names of the output sequences are constructed from the name of the input sequence, the type of feature being output (i.e. cds, mrna, pro) and a unique ordinal number for this type to distinguish it from others in this sequence. The name, type and number of separated by underscore characters. Thus the second CDS feature in the sequence 'A12345' would be named 'A12345_cds_2'. The translations are not made from the coding sequence, they are extracted directly from the translation sequence held in the feature table. Output files for usage example File: x03487.cds >x03487_cds_1 atgacgaccgcgtccacctcgcaggtgcgccagaactaccaccaggactcagaggccgcc atcaaccgccagatcaacctggagctctacgcctcctacgtttacctgtccatgtcttac tactttgaccgcgatgatgtggctttgaagaactttgccaaatactttcttcaccaatct catgaggagagggaacatgctgagaaactgatgaagctgcagaaccaacgaggtggccga atcttccttcaggatatcaagaaaccagactgtgatgactgggagagcgggctgaatgca atggagtgtgcattacatttggaaaaaaatgtgaatcagtcactactggaactgcacaaa ctggccactgacaaaaatgacccccatttgtgtgacttcattgagacacattacctgaat gagcaggtgaaagccatcaaagaattgggtgaccacgtgaccaacttgcgcaagatggga gcgcccgaatctggcttggcggaatatctctttgacaagcacaccctgggagacagtgat aatgaaagctaa File: x03487.mrna >x03487_mrna_1 cagacgttcttcgccgagagtcgtcggggtttcctgcttcaacagtgcttggacggaacc cggcgctcgttccccaccccggccggccgcccatagccagccctccgtcgacctcttcac cgcaccctcggactgccccaaggcccccgccgccgctccagcgccgcgcagccaccgccg ccgccgccgcctctccttagtcgccgccatgacgaccgcgtccacctcgcaggtgcgcca gaactaccaccaggactcagaggccgccatcaaccgccagatcaacctggagctctacgc ctcctacgtttacctgtccatg File: x03487.prot >x03487_pro_1 MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQS HEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHK LATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSD NES File: x03487.noncoding >x03487_noncoding_1 agnncaaacctnagctccgccagagcgcgcgaggcctccagcggccgcccctcccccaca gcaggggcggggntcccgcgcccaccggaaggagcgggctcggggcgggcggcgctgatt ggccggggcgggcctgacgccgacgcggctataagagaccacaagcgacccgcagggc >x03487_noncoding_501 gtgagcgcgggc File: x03487.coderet CDS mRNA non-c Trans Total Sequence ===== ===== ===== ===== ===== ======== 1 1 6 1 8 X03487 Output files for usage example 2 File: x03487.coderet mRNA Total Sequence ===== ===== ======== 1 1 X03487 Data files None. Notes One or more of CDS, mRNA, translation or non-coding regions can be excluded from output with the appropriate qualifiers; "no" is prepended to the qualifier name, for example -nocds would exclude the coding sequence. The translations are not made from the coding sequence, they are extracted directly from the translation sequence held in the feature table. The regions of the feature table that concern us are shown below. This specifies that the coding sequence for the gene is constructed by joining several sections of code, many of which are in other entries in this database: FT CDS join(U21925.1:818..987,U21926.1:258..420, FT U21927.1:428..520,U21928.1:196..336,U21929.1:279..415, FT U21930.1:895..1014,516..708) This specifies that the messenger RNA sequence for the gene is constructed by joining several sections of code, many of which are in other entries in this database. FT mRNA join(M88628.1:1006..1318,M88629.1:221..342, FT M88630.1:101..223,M88631.1:46..258,M88632.1:104..172, FT M88633.1:387..503,M88634.1:51..272,M88635.1:303..564, FT M88635.1:849..1020,M88636.1:282..375,M88637.1:39..253, FT M88638.1:91..241,M88639.1:168..377,M88640.1:627..3732, FT M88641.1:158..311,M88642.1:1051..1263,M88642.1:1550..1778, FT M88642.1:1986..2168,M88642.1:3904..4020, FT M88642.1:4627..4698,M88643.1:39..124,M88644.1:42..197, FT M88645.1:542..686,M88646.1:75..223,M88647.1:109..285, FT 253..2211) This specifies that the translation of the coding region is as follows: FT /translation="MAQDSVDLSCDYQFWMQKLSVWDQASTLETQQDTCLHVAQFQEFL FT RKMYEALKEMDSNTVIERFPTIGQLLAKACWNPFILAYDESQKILIWCLCCLINKEPQN FT SGQSKLNSWIQGVLSHILSALRFDKEVALFTQGLGYAPIDYYPGLLKNMVLSLASELRE FT NHLNGFNTQRRMAPERVASLSRVCVPLITLTDVDPLVEALLICHGREPQEILQPEFFEA FT VNEAILLKKISLPMSAVVCLWLRHLPSLEKAMLHLFEKLISSERNCLRRIECFIKDSSL FT PQAACHPAIFRVDEMFRCALLETDGALEIIATIQVFTQCFVEALEKASKQLRFALKTYF FT PYTSPSLAMVLLQDPQDIPRGHWLQTLKHISELLREAVEDQTHGSCGGPFESWFLFIHF FT GGWAEMVAEQLLMSAAEPPTALLWLLAFYYGPRDGRQQRAQTMVQVKAVLGHLLAMSRS FT SSLSAQDLQTVAGQGTDTDLRAPAQQLIRHLLLNFLLWAPGGHTIAWDVITLMAHTAEI FT THEIIGFLDQTLYRWNRLGIESPRSEKLARELLKELRTQV" References None. Warnings None. Diagnostic Error Messages None. Exit status It always exits with status 0. Known bugs None. See also Program name Description abiview Display the trace in an ABI sequencer file backtranambig Back-translate a protein sequence to ambiguous nucleotide sequence backtranseq Back-translate a protein sequence to a nucleotide sequence checktrans Report STOP codons and ORF statistics of a protein entret Retrieve sequence entries from flatfile databases and files extractalign Extract regions from a sequence alignment infoalign Display basic information about a multiple sequence alignment infoseq Display basic information about sequences plotorf Plot potential open reading frames in a nucleotide sequence prettyseq Write a nucleotide sequence and its translation to file refseqget Get reference sequence remap Display restriction enzyme binding sites in a nucleotide sequence seqxref Retrieve all database cross-references for a sequence entry seqxrefget Retrieve all cross-referenced data for a sequence entry showalign Display a multiple sequence alignment in pretty format showorf Display a nucleotide sequence and translation in pretty format showseq Display sequences with features in pretty format sixpack Display a DNA sequence with 6-frame translation and ORFs transeq Translate nucleic acid sequences variationget Get sequence variations whichdb Search all sequence databases for an entry and retrieve it Author(s) Alan Bleasby European Bioinformatics Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SD, UK Please report all bugs to the EMBOSS bug team (emboss-bug (c) emboss.open-bio.org) not to the original author. History Written (Nov 2000) - Alan Bleasby. Target users This program is intended to be used by everyone and everything, from naive users to embedded scripts. Comments None